WRIZEM-23 Scolopendromorpha

Sample information

Picture
Entry by: Zion M.
Location
Collection date 01/29/2025
Captive / Cultivated? Wild-caught
Group Georgia Southern University
Observations

Date: 01/29/2025
Time: 1:45 pm
Location: Next to the Learning Commons
Habitat: Covered with leaves and in the dirt
Method of Collection: By hand

Putative identification Arthropoda Chilopoda Scolopendromorpha

Methods

Extraction kit
DNA extraction location Abdomen
Single or Duplex PCR Single Reaction
Gel electrophoresis system Standard electrophoresis system
Buffer TAE
DNA stain Other
Gel images
Protocol notes

DNA extraction kit of in-house reagents was used.

Results

Wolbachia presence No
Confidence level High
Explanation of confidence level

The controls worked and matched my results as well as my partner’s.

Wolbachia 16S sequence
Arthropod COI sequence
ASMAGTALSLIIRLELSQPGTLIGDDQTYNTIVTAHAFVMIFFMVMPIMIGGFGNWLTPL
BLAST at The Wolbachia Project   BLAST at NCBI
Summary The Scolopendromorpha was found to be negative for Wolbachia.
Report Inappropriate Post