Sample information |
|
| Picture |
|
|---|---|
| Location | |
| Collection date | 01/29/2025 |
| Captive / Cultivated? | Wild-caught |
| Group | Georgia Southern University |
| Observations | Date: 01/29/2025 |
| Putative identification | Arthropoda Chilopoda Scolopendromorpha |
Methods |
|
| Extraction kit | |
| DNA extraction location | Abdomen |
| Single or Duplex PCR | Single Reaction |
| Gel electrophoresis system | Standard electrophoresis system |
| Buffer | TAE |
| DNA stain | Other |
| Gel images |
|
| Protocol notes | DNA extraction kit of in-house reagents was used. |
Results |
|
| Wolbachia presence | No |
| Confidence level | High |
| Explanation of confidence level | The controls worked and matched my results as well as my partner’s. |
| Wolbachia 16S sequence | |
| Arthropod COI sequence |
ASMAGTALSLIIRLELSQPGTLIGDDQTYNTIVTAHAFVMIFFMVMPIMIGGFGNWLTPL
BLAST at The Wolbachia Project BLAST at NCBI
|
| Summary | The Scolopendromorpha was found to be negative for Wolbachia. |


Common Eastern Bumble Bee (Bombus impatiens)
American Bird
Spotted crane fly
Wolbachia data
Meadow Katydid